| Desktop | 0/100 | ✘ |
| Mobile | 0/100 | ✘ |
| Field | Data | Result |
|---|---|---|
| Page Size | 42 KB | ✔ |
| Compression | 12 KB (-72.6%) | ✔ |
| Text/Html Ratio | 4360 / 43244 (bytes) = 10.08% | ✔ |
| Load Time | 0.96 second | ✔ |
| Mobile Ready | 0/100 | ✘ |
| In-Page Links | 52 | ✔ |
| Doc Type | HTML 5 | ✔ |
| Encoding | UTF-8 | ✔ |
| Declared Language | German | ✔ |
| Preferred Domain | Yes | ✔ |
| Robots.txt | Yes | ✔ |
| Url Rewrite | No | ✔ |
| Underscores in url | Yes | ✘ | Images Without ALT | 2 / 5 | ✘ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | No | ✔ |
| Iframe | No | ✔ |
| Custom 404 page | Yes | ✔ |
| Email Privacy | Yes | ✔ |
| Gsafe browsing | Yes | ✔ |
| Analytics | Yes | ✔ |
| W3C Validity | No | ✘ |
| Keywords | Freq | Title | Desc | <H> |
|---|---|---|---|---|
| worterbuch | 17 | ✘ | ✘ | ✘ |
| deutsch-englisch | 6 | ✘ | ✘ | ✘ |
| deutsch-russische | 5 | ✘ | ✘ | ✘ |
| englisch-deutsch | 5 | ✘ | ✘ | ✘ |
| wörterbuch | 4 | ✘ | ✘ | ✘ |
| deutsch-russisch | 4 | ✘ | ✘ | ✘ |
| russische-deutsch | 3 | ✘ | ✘ | ✘ |
| russisch-deutsch | 3 | ✘ | ✘ | ✘ |
| kleines | 2 | ✘ | ✘ | ✘ |
| auto-service | 2 | ✘ | ✘ | ✘ |
| erklärungen | 1 | ✘ | ✘ | ✘ |
| dictionnaire | 1 | ✘ | ✘ | ✘ |
| griechisch-deutsches | 1 | ✘ | ✘ | ✘ |
| sprachenabchasischadygheafrikaansainualbanischalsacienaltaischesprachenaltostslawischesprachearabischarmenischaserbaidschanischavaricaymarabaschkirischbaskischbelorussischbulgarischchamorrochechencherokeechinesischchuvashdänischdeutschenglischersjanischespracheesperantoestnischewenkischefäröischfinnischfranzösischgalizischgeorgischgriechischhaitianhebräischhindiholländischindonesischinguschenirischischorischespracheisländischitalienischjapanischjiddishjorubakambodschanischkaratschaikasachischkatalanischklingonischekoreanischkrimtatarischsprachekroatischkumykischekurdischlateinischlettischlingalalitauischmalaysischmaltesischmaorischmarimayamazedonischmokshamongolischnorwegischoldchurchslavonicossetianpālipapiamentopaschtupersischpolnischportugiesischpundjabischquechuaquenyarumänischrussischschwedischserbischshorslowakischslowenischspanischsuahelitadschikischtagalogtamilischtatarischthaitschechischtürkischturkmenischudmurtischespracheuigurukrainischungarischurduurumusbekischvietnamesischwepsischesprachewotische | 1 | ✘ | ✘ | ✘ |
| alle | 1 | ✘ | ✘ | ✘ |
|
With 0.96 seconds in page load, 42 KB of page size and all other reports below, the deacademic.com has a SEO score of 69 out of 100 |
| Title | Wörterbücher und Enzyklopädien auf der Akademik |
| Description | Wörterbücher und Enzyklopädien auf der Akademik |
| Keyword | Wörterbücher, Enzyklopädien, Lexicon, Akademik |
| Age | 9 Years, 95 Days |
| Created | 20th-Sep-2011 |
| Updated | 9th-Oct-2020 |
| Expiry | 20th-Sep-2021 |
| Host | Type | Ttl | Other |
|---|---|---|---|
| deacademic.com | A | 37 | ip:3.6.18.84 |
| deacademic.com | A | 37 | ip:3.6.118.31 |
| deacademic.com | NS | 172800 | target:badger.ezoicns.com |
| deacademic.com | NS | 172800 | target:beetle.ezoicns.com |
| deacademic.com | NS | 172800 | target:gerbil.ezoicns.com |
| deacademic.com | NS | 172800 | target:lizard.ezoicns.com |
| deacademic.com | SOA | 900 | mname:badger.ezoicns.comrname:awsdns-hostmaster.amazon.comserial:1refresh:7200retry:900expire:1209600minimum-ttl:86400 |
| deacademic.com | MX | 300 | pri:10target:ezmail.deacademic.com |
|
Domain Name: DEACADEMIC.COM Registry Domain ID: 1677949904_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.nic.ru Registrar URL: http://www.nic.ru Updated Date: 2020-10-09T20:32:26Z Creation Date: 2011-09-20T02:25:51Z Registrar Registration Expiration Date: 2021-09-19T21:00:00Z Registrar: Regional Network Information Center, JSC dba RU-CENTER Registrar IANA ID: 463 Registrar Abuse Contact Email: tld-abuse@nic.ru Registrar Abuse Contact Phone: +7.4959944601 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registry Registrant ID: Registrant Name: Privacy protection service - whoisproxy.ru Registrant Organization: Privacy protection service - whoisproxy.ru Registrant Street: PO box 99, whoisproxy.ru Registrant City: Moscow Registrant State/Province: Moscow Registrant Postal Code: 123308 Registrant Country: RU Registrant Phone: +7.4957856536 Registrant Phone Ext: Registrant Email: deacademic.com@whoisproxy.ru Registry Admin ID: Admin Name: Privacy protection service - whoisproxy.ru Admin Organization: Privacy protection service - whoisproxy.ru Admin Street: PO box 99, whoisproxy.ru Admin City: Moscow Admin State/Province: Moscow Admin Postal Code: 123308 Admin Country: RU Admin Phone: +7.4957856536 Admin Phone Ext: Admin Email: deacademic.com@whoisproxy.ru Registry Tech ID: Tech Name: Privacy protection service - whoisproxy.ru Tech Organization: Privacy protection service - whoisproxy.ru Tech Street: PO box 99, whoisproxy.ru Tech City: Moscow Tech State/Province: Moscow Tech Postal Code: 123308 Tech Country: RU Tech Phone: +7.4957856536 Tech Phone Ext: Tech Email: deacademic.com@whoisproxy.ru Name Server: badger.ezoicns.com Name Server: beetle.ezoicns.com Name Server: gerbil.ezoicns.com DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ For more information on Whois status codes, please visit: https://icann.org/epp >>> Last update of WHOIS database: 2020.12.23T21:58:07Z |
| Server IP | 18.156.95.187 |
| Server Location | Germany |
| Service Provider | Amazon.com |
| Domains (TLD) | Status |
|---|---|
| deacademic.net | Available |
| deacademic.org | Already Registered |
| deacademic.biz | Already Registered |
| deacademic.io | Already Registered |
| deacademic.info | Available |
| Domains (TLD) | Status |
|---|---|
| xeacademic.com | Available |
| seacademic.com | Available |
| weacademic.com | Already Registered |
| eeacademic.com | Available |
| reacademic.com | Available |
| Ponaflexusa.com |
| Weboptica.ru |
| Hotelss.net |
| Dgyurong.com |
| Perlfoundation.org |
| Mosi.org |
| Lock.cn |
| Bedpari.com |
| Sayezviajero.com |
| Hmanuals.net |